Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-32 alpha (Interleukin-32 alpha) protein, AF

Interleukin 32 alpha (IL-32α) is an 18 kDa cytokine with 131 amino acid residues and one of the IL-2 splice variants. IL-32α is primarily secreted from inflammatory cells, such as NK cells, T-cells, peripheral blood mononuclear cells (PBMCs), and monocytes. IL-32 alpha is a proinflammatory cytokine regulating IL-6 by interaction with protein kinase C (PKC) . It also interacts with paxillin, integrin, and focal adhesion kinase 1 (FAK 1) .

Product Specifications

Synonyms

IL-32alpha, IL-32beta, IL-32delta, IL-32gamma, NK4, TAIF, TAIFa, TAIFb, TAIFc, TAIFd

Gene Name

IL32

UniProt

P24001

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce TNF alpha secretion in RAW264.7 cells. The ED50 for this effect is <10 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 15.72 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK with polyhistidine tag at the C-terminus .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Porcine HAVCR1 Protein (hIgG1 Fc Tag)
PDMP100005-01 20 µg

Recombinant Porcine HAVCR1 Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Porcine HAVCR1 Protein (hIgG1 Fc Tag)
PDMP100005-02 100 µg

Recombinant Porcine HAVCR1 Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Porcine HAVCR1 Protein (hIgG1 Fc Tag)
PDMP100005-03 500 µg

Recombinant Porcine HAVCR1 Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Porcine HAVCR1 Protein (hIgG1 Fc Tag)
PDMP100005-04 1 mg

Recombinant Porcine HAVCR1 Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
AGPAT5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D12]
TA504192BM 100 µL

AGPAT5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D12]

Sign In for Pricing
View Details
Claudin 14 (CLDN14) (NM_001146079) Human Over-expression Lysate
LY431799 100 µg

Claudin 14 (CLDN14) (NM_001146079) Human Over-expression Lysate

Sign In for Pricing
View Details