Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-32 alpha (Interleukin-32 alpha) protein, AF

Interleukin 32 alpha (IL-32α) is an 18 kDa cytokine with 131 amino acid residues and one of the IL-2 splice variants. IL-32α is primarily secreted from inflammatory cells, such as NK cells, T-cells, peripheral blood mononuclear cells (PBMCs), and monocytes. IL-32 alpha is a proinflammatory cytokine regulating IL-6 by interaction with protein kinase C (PKC) . It also interacts with paxillin, integrin, and focal adhesion kinase 1 (FAK 1) .

Product Specifications

Synonyms

IL-32alpha, IL-32beta, IL-32delta, IL-32gamma, NK4, TAIF, TAIFa, TAIFb, TAIFc, TAIFd

Gene Name

IL32

UniProt

P24001

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce TNF alpha secretion in RAW264.7 cells. The ED50 for this effect is <10 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 15.72 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK with polyhistidine tag at the C-terminus .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCRN3 (NM_024583) Human Recombinant Protein
TP316491L 1 mg

SCRN3 (NM_024583) Human Recombinant Protein

Sign In for Pricing
View Details
FRMPD4 (NM_014728) Human Recombinant Protein
TP315568M 100 µg

FRMPD4 (NM_014728) Human Recombinant Protein

Sign In for Pricing
View Details
Dual Caspase 1 and Mitochondrial Membrane Potential Assay Kit
MITCAP600-1 25 Tests

Dual Caspase 1 and Mitochondrial Membrane Potential Assay Kit

Sign In for Pricing
View Details
D-VLK-AMC [D-Val-Leu-Lys-AMC]
13201-AAT 5 mg

D-VLK-AMC [D-Val-Leu-Lys-AMC]

Sign In for Pricing
View Details
Human ADAT3 activation kit by CRISPRa
GA114392 1 Kit

Human ADAT3 activation kit by CRISPRa

Sign In for Pricing
View Details
CRLF3 Recombinant Rabbit monoclonal Antibody
HA750913 100 µL

CRLF3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details