Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant BMP-5 (Bone morphogenetic protein-5) protein, AF

Bone Morphogenetic Protein-5 (BMP-5) is an extracellular multifunctional signaling cytokine that is also a member of the TGF-β family. BMP-5 can bind with TGF-β receptors and trigger SMAD protein signal transduction. It is involved in many negatively regulated physiological processes, such as the aldosterone biosynthetic process and epithelial to mesenchymal transition. BMP-5 also plays a vital role in cartilage synthesis.

Product Specifications

Gene Name

BMP5

UniProt

P22003

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <0.17 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 16.57 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZRANB2 (Zinc Finger Ran-Binding Domain-Containing Protein 2, Zinc Finger, RAN-Binding Domain Containing 2)
496953 100 µL

ZRANB2 (Zinc Finger Ran-Binding Domain-Containing Protein 2, Zinc Finger, RAN-Binding Domain Containing 2)

Sign In for Pricing
View Details
Rabbit Polyclonal COX15 Antibody
NBP1-59560 100 µL

Rabbit Polyclonal COX15 Antibody

Sign In for Pricing
View Details
Histone cluster 1 H2AE CRISPR Activation Plasmid (h)
sc-410812-ACT 20 µg

Histone cluster 1 H2AE CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Minoxidil hydrochloride
orb3174309-01 10 mg

Minoxidil hydrochloride

Sign In for Pricing
View Details
Minoxidil hydrochloride
orb3174309-02 50 mg

Minoxidil hydrochloride

Sign In for Pricing
View Details
SARS-CoV-2 S1 RBD, B.1.617.2 Delta
MBS313693-01 1 mg

SARS-CoV-2 S1 RBD, B.1.617.2 Delta

Sign In for Pricing
View Details