Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant SCF protein, AF

Stem Cell Factor (SCF) is a 166-amino-acid protein with a monomeric molecular weight of approximately 18.5 kDa. SCF is the ligand for the tyrosine kinase receptor c-kit, which regulates other Growth Factorss, such as granulocyte colony-stimulating factor (G-CSF), granulocyte macrophage-colony-stimulating factor (GM-CSF), and interleukin-3 to stimulate proliferation, and differentiation of hematopoietic stem cells. SCF can be produced by a variety of cells, including fibroblasts, smooth muscle, endothelial cells, mast cells and bone marrow macrophages endothelial cells.

Product Specifications

Synonyms

DCUA, DFNA69, FPH2, FPHH, KL-1, Kitl, MGF, SF, SHEP7, SLF, KIT ligand

Gene Name

KITLG

UniProt

P21583

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <5 ng/mL. The specific activity of recombinant human SCF is > 5 x 105 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 19.4 kDa. The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA with polyhistidine tag at the C-terminus

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-RGS19 (Ser24) Antibody Blocking Peptide
orb1503419 500 µg

Phospho-RGS19 (Ser24) Antibody Blocking Peptide

Sign In for Pricing
View Details
Zebrafish traf7 Antibody APC Conjugated
orb3157699 200 µL

Zebrafish traf7 Antibody APC Conjugated

Sign In for Pricing
View Details
Anti-Human CMA1 Polyclonal Antibody
PHD61101 100 μg

Anti-Human CMA1 Polyclonal Antibody

Sign In for Pricing
View Details
LRRC14 shRNA Plasmid (h)
sc-77597-SH 20 µg

LRRC14 shRNA Plasmid (h)

Sign In for Pricing
View Details
Lrfn5 3'UTR Luciferase Stable Cell Line
TU212522 1.0 mL

Lrfn5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Pig Inhibin beta A chain (INHBA)
MBS954787-01 0.02 mg (E-Coli)

Recombinant Pig Inhibin beta A chain (INHBA)

Sign In for Pricing
View Details