Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant Pleiotrophin protein, AF

Pleiotrophin (PTN) also known as HB-GAM, which is a Growth Factors involves in widely range of biological events such as bone development, neural regeneration, inflammatory response, tissue repair. PTN is 18.9 kDa protein containing 168 residues that expressed in Osteoblast and brain. Besides, PTN has been revealed to suppress the long-term potentiation (LTP) in hippocampus and plays a critical role in modulating learning-related behavior. On the other hand, PTN also acts as an angiogenic factor that promotes tumor progression by PTN/Anaplastic Lymphoma Kinase (ALK) axis.

Product Specifications

Synonyms

PTN, Heparin Affin Regulatory Protein (HARP), Heparin-Binding Growth Factor-8 (HBGF-8), Osteoblast-Specific Factor 1 (OSF-1)

Gene Name

PTN

UniProt

P21246

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.01 EU per 1 μg of the protein by the LAL method.

Bioactivity

Testing in process

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 19.89 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IL-12 Antibody Pair Set
E-KAB-0377 50 µL & 100 µg

Rat IL-12 Antibody Pair Set

Sign In for Pricing
View Details
Recombinant alpha Synuclein Antibody
RC-15356-01 50 μL

Recombinant alpha Synuclein Antibody

Sign In for Pricing
View Details
Recombinant alpha Synuclein Antibody
RC-15356-02 100 µL

Recombinant alpha Synuclein Antibody

Sign In for Pricing
View Details
Recombinant alpha Synuclein Antibody
RC-15356-03 1 mL

Recombinant alpha Synuclein Antibody

Sign In for Pricing
View Details
CDC25B Polyclonal Antibody
E-AB-12785-01 20 µL

CDC25B Polyclonal Antibody

Sign In for Pricing
View Details
CDC25B Polyclonal Antibody
E-AB-12785-02 60 µL

CDC25B Polyclonal Antibody

Sign In for Pricing
View Details