Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CXCL3 (C-X-C motif chemokine 3) protein, AF

C-X-C motif chemokine 3 (CXCL3) also named Growth-regulated oncogene gamma (GROγ), which is a chemokine of the intercrine alpha family. CXCL3 is a 8kDa protein containing 73 amino acid residues. During inflammation, CXCL3 is activated by the TNF and IL-1 which mediates the monocytes migration and adhesion by targeting the CXCR2. CXCL3 activates the JNK activity which induce the cell differentiation.

Product Specifications

Synonyms

GRO-γ: MGSAγ, MIP-2β, GRO3

Gene Name

CXCL3

UniProt

P19876

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <2 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 8.67 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN with polyhistidine tag at the N-terminus.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDH5 Antibody, FITC conjugated
A42709-100UG 100 µg

CDH5 Antibody, FITC conjugated

Sign In for Pricing
View Details
Human Laminin Alpha 4, LAMa4 ELISA KIT
E3439Hu-01 48 Well

Human Laminin Alpha 4, LAMa4 ELISA KIT

Sign In for Pricing
View Details
Human Laminin Alpha 4, LAMa4 ELISA KIT
E3439Hu-02 96 Well

Human Laminin Alpha 4, LAMa4 ELISA KIT

Sign In for Pricing
View Details
Human Laminin Alpha 4, LAMa4 ELISA KIT
E3439Hu-03 5x 96 Tests

Human Laminin Alpha 4, LAMa4 ELISA KIT

Sign In for Pricing
View Details
Human Laminin Alpha 4, LAMa4 ELISA KIT
E3439Hu-04 10x 96 Tests

Human Laminin Alpha 4, LAMa4 ELISA KIT

Sign In for Pricing
View Details
APEG1 Protein, Human, Recombinant (His)
MF-0062974-01 5 µg

APEG1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details