Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CXCL3 (C-X-C motif chemokine 3) protein, AF

C-X-C motif chemokine 3 (CXCL3) also named Growth-regulated oncogene gamma (GROγ), which is a chemokine of the intercrine alpha family. CXCL3 is a 8kDa protein containing 73 amino acid residues. During inflammation, CXCL3 is activated by the TNF and IL-1 which mediates the monocytes migration and adhesion by targeting the CXCR2. CXCL3 activates the JNK activity which induce the cell differentiation.

Product Specifications

Synonyms

GRO-γ: MGSAγ, MIP-2β, GRO3

Gene Name

CXCL3

UniProt

P19876

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <2 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 8.67 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN with polyhistidine tag at the N-terminus.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Drosophila melanogaster Innexin inx6 (inx6), partial
MBS7102690 Inquire

Recombinant Drosophila melanogaster Innexin inx6 (inx6), partial

Sign In for Pricing
View Details
ARHGAP11A Protein Vector (Human) (pPB-His-MBP)
PV323246 500 ng

ARHGAP11A Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Cbp Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV653929 1.0 µg DNA

Cbp Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human DOM3Z (Decapping and exoribonuclease protein) ELISA Kit
MBS7617812-01 48 Well

Human DOM3Z (Decapping and exoribonuclease protein) ELISA Kit

Sign In for Pricing
View Details
Human DOM3Z (Decapping and exoribonuclease protein) ELISA Kit
MBS7617812-02 96 Well

Human DOM3Z (Decapping and exoribonuclease protein) ELISA Kit

Sign In for Pricing
View Details
Human DOM3Z (Decapping and exoribonuclease protein) ELISA Kit
MBS7617812-03 5x 96 Well

Human DOM3Z (Decapping and exoribonuclease protein) ELISA Kit

Sign In for Pricing
View Details