Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Swine recombinant IL-1 alpha (Interleukin-1 alpha) protein, AF

Interleukin 1-alpha (IL-1α), also named hematopoietin 1, is a 17.65 kDa cytokine with 159 amino acid residues. IL-1α is mainly expressed in macrophages, neutrophils, epithelial cells, and endothelial cells. When IL-1α binds to the IL-1 receptor, It mediates a wide variety of biological processes such as cell division, angiogenesis, production of interleukin-2, and cellular sodium ion homeostasis. In addition, IL-1α also plays a critical role in immune responses, such as fever and inflammation, and triggers tumor necrosis factor-alpha.

Product Specifications

Synonyms

IL1A

Gene Name

IL1A

UniProt

P18430

Reactivity

Swine

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce D10.G4.1 cells proliferation. The ED50 for this effect is 50 pg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 19.02 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MSATYSFQSNMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQLPVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPKLFIATRQEKLVHMAPGLPSVTDFQILENQS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-100 1x 100 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
BNC881037-100 1x 100 µL

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
BNC400676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-500 1x 500 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-100 1x 100 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF640R conjugate, 0.1mg/mL
BNC400449-500 1x 500 µL

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details