Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant Galectin-3 protein, AF

Galectin-3 (Gal-3) is one of the lectin family members, which is the only chimera?type galectin, containing one carbohydrate recognition domain (CRD) connected to a long, flexible N?terminal domain. The C?terminal CRD is responsible for β-galactoside binding, and the N?terminal domain is essential for its multimerization, and interaction with other intracellular proteins. Galectin-3 is predominantly presented in the cytoplasm and expressed on the cell surface, and then often secreted into biological fluids, such as serum and urine. Numerous studies have indicated that galectin-3 plays a crucial role in cell proliferation, apoptosis, gene expression, immune surveillance, inflammation, fibrosis, and host defense.

Product Specifications

Synonyms

IgE-binding protein, MAC2, L-29, CPB-35

Gene Name

LGALS3

UniProt

P17931

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measured by its ability to chemoattract human PBMC using a concentration range of 2.5-25 μg/mL. Note: Results may vary from different PBMC donors.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 27 kDa. The protein migrates as 32 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFM (N-term) Rabbit Polyclonal Antibody
AP50105PU-N 400 µL

AFM (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ccdc66 Mouse Gene Knockout Kit (CRISPR)
KN502735 1 Kit

Ccdc66 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-(4-Chlorophenyl)-1-imidazol-1-yl-(butan-d5)-2-ol
TRC-C379542-25MG 25 mg

4-(4-Chlorophenyl)-1-imidazol-1-yl-(butan-d5)-2-ol

Sign In for Pricing
View Details
PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (NAT105), CF647 conjugate, 0.1mg/mL
BNC470896-500 1x 500 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (NAT105), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Procyclidine-d11 Hydrochloride
TRC-P755842-1MG 1 mg

Procyclidine-d11 Hydrochloride

Sign In for Pricing
View Details
Supt4a Mouse Gene Knockout Kit (CRISPR)
KN516991 1 Kit

Supt4a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details