Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-9 (Interleukin-9) protein, AF

Interleukin 9 (IL-9) is a pleiotropic cytokine that had pleiotropic functions in the immune system, has a molecular mass of 14.5 kDa. The major source of IL-9 is T lymphocytes. It is secreted by CD4+ helper cells that acts as a regulator of a variety of hematopoietic cells.

Product Specifications

Synonyms

P40 cytokine, T-cell growth factor p40, HP40

Gene Name

IL9

UniProt

P15248

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.01 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is <0.25 ng/mL. The specific activity of recombinant human IL-9 is approximately >5 x106 IU/ mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 14.93 kDa. The protein migrates as 13-17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Mouse CD90 Antibody[M5/49.4.1]
E-AB-F1283UD-01 25 µg

PE Anti-Mouse CD90 Antibody[M5/49.4.1]

Sign In for Pricing
View Details
PE Anti-Mouse CD90 Antibody[M5/49.4.1]
E-AB-F1283UD-02 100 µg

PE Anti-Mouse CD90 Antibody[M5/49.4.1]

Sign In for Pricing
View Details
Human FYB2 activation kit by CRISPRa
GA116323 1 Kit

Human FYB2 activation kit by CRISPRa

Sign In for Pricing
View Details
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF640R conjugate, 0.1mg/mL
BNC401531-500 1x 500 µL

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human SCF/c-kit Ligand Protein (Fc Tag)
PDMH100305-01 20 µg

Recombinant Human SCF/c-kit Ligand Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human SCF/c-kit Ligand Protein (Fc Tag)
PDMH100305-02 100 µg

Recombinant Human SCF/c-kit Ligand Protein (Fc Tag)

Sign In for Pricing
View Details