Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CCL4 (C-C motif chemokine ligand 4) protein, AF

C-C Motif Chemokine Ligand 4 (CCL4) is a 7.66 kDa cytokine with 69 amino acid residues. CCL4, also named macrophage inflammatory protein-1β (MIP-1β), is mainly secreted from neutrophils, monocytes, B cells, T cells, fibroblasts, endothelial cells and epithelial cells. CCL4 recruits various immune cells like natural killer cells, monocytes, and neutrophils when CCL4 binds to CCR5. In addition, CCL4 mediates lymphocyte adhesion by Rac1 /Cdc42 signaling pathway and plays critical roles in different biological functions like maintenance of cell polarity, regulation of calcium ion transport and response to viruses.

Product Specifications

Synonyms

MIP-1b: Macrophage Inflammatory Protein-1β, ACT-2

Gene Name

CCL4

UniProt

P13236

Reactivity

Human

Tag

Tag Free

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED50 for this effect is <10 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 50 mM Tris and 150 mM NaCl, pH 8.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 7.75 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

APMGSDPPTACCFSYTARKLPHNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse DOMON domain-containing protein FRRS1L (FRRS1L) ELISA Kit
abx524339 96 Tests

Mouse DOMON domain-containing protein FRRS1L (FRRS1L) ELISA Kit

Sign In for Pricing
View Details
Equilibration/Wash Buffer 2.0
MBS689647 250 mL

Equilibration/Wash Buffer 2.0

Sign In for Pricing
View Details
YAP1P1 3'UTR Luciferase Stable Cell Line
TU028629 1.0 mL

YAP1P1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Chymase 1, Mast Cell (CMA1) ELISA Kit
abx353292 96 Well

Mouse Chymase 1, Mast Cell (CMA1) ELISA Kit

Sign In for Pricing
View Details
Bulk Anti-Human CD4 (OKT-4) Antibody - Ultra-Low Endotoxin
ICH1166UL-100mg 100 mg

Bulk Anti-Human CD4 (OKT-4) Antibody - Ultra-Low Endotoxin

Sign In for Pricing
View Details
PABPN1L Antibody (Center) [APR30864G]
APR30864G-01 50 µL

PABPN1L Antibody (Center) [APR30864G]

Sign In for Pricing
View Details