Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-7 (Interleukin-7) protein, AF

Interleukin-7 (IL-7) is a multipotent cytokine belonged to one of the members of IL-2 superfamily. IL-7 has diverse effects on the hematopoietic and immune regulations. IL-7 is a trophic factor that is necessary for both B cell and T cell proliferation and development. In addition, it presents potential antitumor effects in tumors such as glioma, melanoma, lymphoma, leukemia, prostate cancer, and glioblastoma.

Product Specifications

Synonyms

Lymphopoietin 1 (LP-1), pre-B-cell factor

Gene Name

IL7

UniProt

P13232

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC) . The ED50 for this effect is <0.8 ng/mL. The specific activity of recombinant human IL-7 is > 1 x 108 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.3 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human S100A6 Protein
PKSH031346 100 µg

Recombinant Human S100A6 Protein

Sign In for Pricing
View Details
CD6 (3F7B5), CF640R conjugate, 0.1mg/mL
BNC400428-500 1x 500 µL

CD6 (3F7B5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse IL13RA1 Protein (His Tag)
PKSM040873 50 µg

Recombinant Mouse IL13RA1 Protein (His Tag)

Sign In for Pricing
View Details
Follistatin (FST) (NM_006350) Human Recombinant Protein
TP315777 20 µg

Follistatin (FST) (NM_006350) Human Recombinant Protein

Sign In for Pricing
View Details
Rab42 Mouse Gene Knockout Kit (CRISPR)
KN514373 1 Kit

Rab42 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Hydroxy Omeprazole Preparation Kit
TRC-H948860-5MG 5 mg

4-Hydroxy Omeprazole Preparation Kit

Sign In for Pricing
View Details