Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant CXCL1 (C-C motif chemokine ligand 1) protein, AF

C-X-C motif chemokine 1 (CXCL1) also named Growth-regulated oncogene alpha (GROα), which is a chemokine of the intercrine alpha family. CXCL1 is a 7.5 kDa protein containing 68 amino acid residues. CXCL1 is often expressed in immune cells such as macrophage and neutrophils. CXCL1 plays an important role with immune responses and cancer progression. CXCL1 activates the cell signal transduction with casepas1 that affects the cell proliferation, differentiation and migration.

Product Specifications

Synonyms

GRO-α: MGSAα, NAP-3, GRO1, KC (murine)

Gene Name

CXCL1

UniProt

P12850

Reactivity

Mouse

Tag

Tag Free

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <15 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 50 mM Tris and 150 mM NaCl, pH 8.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 7.45 kDa. The protein migrates below 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TREML4 Protein Vector (Human) (pPB-N-His)
PV137823 500 ng

TREML4 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Human NEUROD1 activation kit by CRISPRa
GA103175 1 Kit

Human NEUROD1 activation kit by CRISPRa

Sign In for Pricing
View Details
BTK antibody
MBS830686-01 0.1 mL

BTK antibody

Sign In for Pricing
View Details
BTK antibody
MBS830686-02 5x 0.1 mL

BTK antibody

Sign In for Pricing
View Details
Human TFAP2C (Transcription factor AP-2 gamma) ELISA Kit
MBS7612637-01 48 Well

Human TFAP2C (Transcription factor AP-2 gamma) ELISA Kit

Sign In for Pricing
View Details
Human TFAP2C (Transcription factor AP-2 gamma) ELISA Kit
MBS7612637-02 96 Well

Human TFAP2C (Transcription factor AP-2 gamma) ELISA Kit

Sign In for Pricing
View Details