Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant BMP-3 (Bone morphogenetic protein-3) protein, AF

Bone Morphogenetic Protein-3 (BMP-3) is an extracellular multifunctional signaling cytokine that is also a member of the TGF-β family. BMP-3 can bind with TGF-β receptor and participate in SMAD protein signal transduction through triggering pathway-restricted SMAD protein phosphorylation. The primary function of BMP-3 is osteoblast differentiation and Induces bone formation.

Product Specifications

Synonyms

Osteogenin, BMP-3A

Gene Name

BMP3

UniProt

P12645

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to inhibit BMP-2-induced alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 10 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 13.34 kDa. The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Guinea pig IgG Antibody
abx400055-01 1 mL

Rabbit Anti-Guinea pig IgG Antibody

Sign In for Pricing
View Details
Rabbit Anti-Guinea pig IgG Antibody
abx400055-02 10 mL

Rabbit Anti-Guinea pig IgG Antibody

Sign In for Pricing
View Details
Ccl22 (NM_009137) Mouse Untagged Clone
MC200823 10 µg

Ccl22 (NM_009137) Mouse Untagged Clone

Sign In for Pricing
View Details
IL15 Antibody
orb1554570-01 50 μL

IL15 Antibody

Sign In for Pricing
View Details
IL15 Antibody
orb1554570-02 100 µL

IL15 Antibody

Sign In for Pricing
View Details
IL15 Antibody
orb1554570-03 200 µL

IL15 Antibody

Sign In for Pricing
View Details