Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant BMP-3 (Bone morphogenetic protein-3) protein, AF

Bone Morphogenetic Protein-3 (BMP-3) is an extracellular multifunctional signaling cytokine that is also a member of the TGF-β family. BMP-3 can bind with TGF-β receptor and participate in SMAD protein signal transduction through triggering pathway-restricted SMAD protein phosphorylation. The primary function of BMP-3 is osteoblast differentiation and Induces bone formation.

Product Specifications

Synonyms

Osteogenin, BMP-3A

Gene Name

BMP3

UniProt

P12645

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to inhibit BMP-2-induced alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 10 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 13.34 kDa. The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL21P82 sgRNA CRISPR Lentivector (Human) (Target 1)
K1930702 1.0 µg DNA

RPL21P82 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Monkey Clavesin 1 (RLBP1L1) ELISA Kit
GTR10351560 96 Well

Monkey Clavesin 1 (RLBP1L1) ELISA Kit

Sign In for Pricing
View Details
Human glial cell line-derived neurotrophic factor,GDNF ELISA KIT
JOT-EK0122Hu-01 96 Well

Human glial cell line-derived neurotrophic factor,GDNF ELISA KIT

Sign In for Pricing
View Details
Human glial cell line-derived neurotrophic factor,GDNF ELISA KIT
JOT-EK0122Hu-02 48 Well

Human glial cell line-derived neurotrophic factor,GDNF ELISA KIT

Sign In for Pricing
View Details
Ctrl sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4452905 3x 1.0 µg

Ctrl sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
INSM1 Rabbit Polyclonal Antibody (Cy5)
orb946501 100 µL

INSM1 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details