Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant BMP-4 (Bone morphogenetic protein-4) protein, AF

Bone Morphogenetic Protein-4 (BMP-4) is an extracellular multifunctional signaling cytokine that is also a member of the TGF-β family. BMP-4 can bind with the TGF-β receptor and trigger SMAD protein signal transduction. BMP-4 has a significant expression in the prostate, it plays a vital role in the development of mesoderm into bones and the development of the epidermis and Dorsal-Ventral axis.

Product Specifications

Synonyms

BMP-2B, DVR4

Gene Name

BMP4

UniProt

P12644

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <0.58 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium carbonate, pH 9.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 12.88 kDa. The protein migrates as 12 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DENV-1 Envelope protein E/EDIII domain (E106#) (Human, Monoclonal, IgG1, kappa)
A132327 100 µL

Anti-DENV-1 Envelope protein E/EDIII domain (E106#) (Human, Monoclonal, IgG1, kappa)

Sign In for Pricing
View Details
LRIT3 Protein Vector (Mouse) (pPM-C-HA)
PV197456 500 ng

LRIT3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Fcer2a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3887606 1.0 µg DNA

Fcer2a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Guinea pig Charged multivesicular body protein 1a (CHMP1A) ELISA Kit
MBS7220942-01 48 Well

Guinea pig Charged multivesicular body protein 1a (CHMP1A) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Charged multivesicular body protein 1a (CHMP1A) ELISA Kit
MBS7220942-02 96 Well

Guinea pig Charged multivesicular body protein 1a (CHMP1A) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Charged multivesicular body protein 1a (CHMP1A) ELISA Kit
MBS7220942-03 5x 96 Well

Guinea pig Charged multivesicular body protein 1a (CHMP1A) ELISA Kit

Sign In for Pricing
View Details