Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant Midkine protein, AF

Midkine, also known as neurite growth-promoting factor 2 (NEGF2) is a member of a small family of secreted Growth Factorss, furthermore high expression in embryo, and limb E14.5. Mouse midkine shares 87% sequence identity with human midkine. Midkine is a 13.5 kDa protein containing 140 amino acids, which promotes angiogenesis, cell growth, migration, and gene expression of different cell types probably via a multiprotein receptor complex consisting of several molecules.

Product Specifications

Synonyms

MK, NEGF-2, Mek

Gene Name

MDK

UniProt

P12025

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Testing in process

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 14.02 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTSF1L Protein Lysate
OCOA16344-20UG 20 µg

GTSF1L Protein Lysate

Sign In for Pricing
View Details
FGF1 Rabbit Polyclonal Antibody (Fluoro550)
orb3075003 100 µg

FGF1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
ZBTB16 Conjugated Antibody
C33100 100 µL

ZBTB16 Conjugated Antibody

Sign In for Pricing
View Details
CD193 (CCR3) (HRP) discontinued
214591-HRP 100 µL

CD193 (CCR3) (HRP) discontinued

Sign In for Pricing
View Details
Mouse Slc29a4 qPCR Primer Pair
QM63294S 200 Tests

Mouse Slc29a4 qPCR Primer Pair

Sign In for Pricing
View Details
NSUN6 Rabbit Polyclonal Antibody (APC)
orb2657640 100 µg

NSUN6 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details