Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant CCL3 (C-C Motif Chemokine Ligand 3) protein, AF

C-C Motif Chemokine Ligand 3 (CCL3) is a 7.66 kDa cytokine with 69 amino acid residues. CCL3, also known as macrophage inflammatory protein 1-alpha (MIP-1-alpha), is expressed in the spleen, lung, and articular cartilage. Upon binding to the receptor, CCR1, CCR4, or CCR5, CCL3 plays a vital role in immune response, such as inflammation, recruitment of immune cells, and production of IL-1β and TNF. In addition, CCL3 also participates in resistance to type 1 virus infection, astrocyte cell migration, regulation of macromolecule metabolic process, and regulation of ERK1 and ERK2 cascade.

Product Specifications

Synonyms

MIP-1a: Macrophage Inflammatory Protein-1α, LD78α

Gene Name

CCL3

UniProt

P10855

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract human PBMCs using a concentration range of 10.0 - 100.0 ng/mL. Note: Results may vary from different PBMC donors.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 8.69 kDa. The protein migrates about 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-500 1x 500 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-500 1x 500 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF555 conjugate, 0.1mg/mL
BNC551052-500 1x 500 µL

CD3e (B-B12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-100 1x 100 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-500 1x 500 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details