Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant M-CSF (Macrophage colony stimulating factor) protein, AF

Macrophage Colony Stimulating Factor (M-CSF) is a 18.54 kDa member of hematopoietic Growth Factors with 159 amino acid residues. M-CSF produced by osteoblasts and osteoblast precursors. M-CSF stimulates the growth and differentiation of the monocyte lineage, and promotes the survival, proliferation, and functions of mature monocytes/macrophages.

Product Specifications

Synonyms

CSF-1, MGI-IM

Gene Name

CSF1

UniProt

P09603

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant human M-CSF is approximately >2.5x 108 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 13.34 kDa. The protein migrates as 13-26 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS20 Rabbit Polyclonal Antibody (Cy7)
orb1080819 100 µL

RGS20 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Rabbit protein 1/monocyte chemotactic and activating factor, MCP1/MCAF ELISA Kit
SL0179Rb-01 48 Tests

Rabbit protein 1/monocyte chemotactic and activating factor, MCP1/MCAF ELISA Kit

Sign In for Pricing
View Details
Rabbit protein 1/monocyte chemotactic and activating factor, MCP1/MCAF ELISA Kit
SL0179Rb-02 96 Tests

Rabbit protein 1/monocyte chemotactic and activating factor, MCP1/MCAF ELISA Kit

Sign In for Pricing
View Details
Human Galectin 8 (GAL8) ELISA Kit
EKU04325 96 Tests

Human Galectin 8 (GAL8) ELISA Kit

Sign In for Pricing
View Details
PROSER1, NT (PROSER1, C13orf23, KIAA2032, Proline and serine-rich protein 1) (FITC) discontinued
040482-FITC 200 µL

PROSER1, NT (PROSER1, C13orf23, KIAA2032, Proline and serine-rich protein 1) (FITC) discontinued

Sign In for Pricing
View Details
N36 peptide
HY-P5498 1 Each

N36 peptide

Sign In for Pricing
View Details