Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IGF-II (Insulin-like growth factor-II) protein, AF

Mouse Insulin Like Growth Factors 2 (IGF-II) is a 7.34 kDa member of the Insulin-like Growth Factors with 67 amino acid residues. IGF-II is mainly expressed from early embryonic somatic tissues, liver, and epithelial cells lining the surface of the brain. IGF-II is mediating the embryonic development and placental growth, while also promoting tumor growth. IGF-II affects regulation of cell proliferation, growth, migration, differentiation and survival via binding to IGF-I receptor.

Product Specifications

Synonyms

AL033362, Igf-2, M6pr, Mpr, Peg, Peg2

Gene Name

IGF2

UniProt

P09535

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is <6 ng/mL. The specific activity of recombinant mouse IGF-II is > 1.5 x 105 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 8.20 kDa. The protein migrates about 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal to Human ENTPD2
MBS247463-01 0.05 mg

Rabbit Polyclonal to Human ENTPD2

Sign In for Pricing
View Details
Rabbit Polyclonal to Human ENTPD2
MBS247463-02 5x 0.05 mg

Rabbit Polyclonal to Human ENTPD2

Sign In for Pricing
View Details
KIF3B siRNA (Human)
CRH6207-01 15 nmol

KIF3B siRNA (Human)

Sign In for Pricing
View Details
KIF3B siRNA (Human)
CRH6207-02 30 nmol

KIF3B siRNA (Human)

Sign In for Pricing
View Details
Human IL-8 / CXCL8 Protein, His Tag
IL8-H52H3-100ug 100 µg

Human IL-8 / CXCL8 Protein, His Tag

Sign In for Pricing
View Details
Recombinant Macaca fascicularis Interleukin-1 beta (IL1B)
CSB-EP011614MOV-01 20 µg

Recombinant Macaca fascicularis Interleukin-1 beta (IL1B)

Sign In for Pricing
View Details