Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant MMP7 (active) protein, AF

Active matrix metalloproteinase-7 (Active MMP-7) is a 20.07 kDa matrix metalloproteinases with 180 amino acid residues. MMP-7 restricted production by normal mucosal and exocrine gland epithelial cells, as well as by carcinoma cells. Functionally, it involved breakdown of extracellular matrix (casein, gelatins of types I, III, IV, and V, and fibronectin) in normal physiological processes and disease processes. MMP-7 is contributed to early tumor development during carcinogenesis.

Product Specifications

Synonyms

MMP-7, MPSL1, PUMP-1

Gene Name

MMP7

UniProt

P09237

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Testing in process

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 20.07 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRO3 (Tyrosine-protein Kinase SKY, BYK, DTK, RSE, Tyrosine-protein Kinase Receptor TYRO3, Tyrosine-protein Kinase RSE, Tyrosine-protein Kinase SKY, Tyrosine-protein Kinase DTK, Tyrosine-protein Kinase byk) (PE)
MBS6504264-01 0.2 mL

TYRO3 (Tyrosine-protein Kinase SKY, BYK, DTK, RSE, Tyrosine-protein Kinase Receptor TYRO3, Tyrosine-protein Kinase RSE, Tyrosine-protein Kinase SKY, Tyrosine-protein Kinase DTK, Tyrosine-protein Kinase byk) (PE)

Sign In for Pricing
View Details
TYRO3 (Tyrosine-protein Kinase SKY, BYK, DTK, RSE, Tyrosine-protein Kinase Receptor TYRO3, Tyrosine-protein Kinase RSE, Tyrosine-protein Kinase SKY, Tyrosine-protein Kinase DTK, Tyrosine-protein Kinase byk) (PE)
MBS6504264-02 5x 0.2 mL

TYRO3 (Tyrosine-protein Kinase SKY, BYK, DTK, RSE, Tyrosine-protein Kinase Receptor TYRO3, Tyrosine-protein Kinase RSE, Tyrosine-protein Kinase SKY, Tyrosine-protein Kinase DTK, Tyrosine-protein Kinase byk) (PE)

Sign In for Pricing
View Details
Duran Watch Glass Dish 100mm
2132146 10 / PCK

Duran Watch Glass Dish 100mm

Sign In for Pricing
View Details
Recombinant Carnitine Palmitoyltransferase 1C, Brain (CPT1C)
SIPF118Hu01-01 10 µg

Recombinant Carnitine Palmitoyltransferase 1C, Brain (CPT1C)

Sign In for Pricing
View Details
Recombinant Carnitine Palmitoyltransferase 1C, Brain (CPT1C)
SIPF118Hu01-02 50 µg

Recombinant Carnitine Palmitoyltransferase 1C, Brain (CPT1C)

Sign In for Pricing
View Details
Recombinant Carnitine Palmitoyltransferase 1C, Brain (CPT1C)
SIPF118Hu01-03 200 µg

Recombinant Carnitine Palmitoyltransferase 1C, Brain (CPT1C)

Sign In for Pricing
View Details