Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant TNF beta (Tumor necrosis factor beta) protein, AF

Tumor Necrosis Factor Beta (TNF beta) or lymphotoxin-alpha (LT-α) is a 19 kDa tumor necrosis factor family protein with 171 amino acid residues. TNF beta is mainly expressed from lymphocytes, and mediates variety of inflammatory, immunostimulatory, and antiviral responses. TNF beta also involves development in secondary lymphoid organs. It is cytotoxic for different tumor cells in vitro and in vivo.

Product Specifications

Synonyms

TNFSF1B, Lymphotoxin-alpha (LT-α), LTalpha, Ltx, TNF-be, TNFSF1, Tnf, Tnfb, Tnfsf, Tnfsf1b, Tnlg1e, hlb38, hlb382, lymph

Gene Name

Lta

UniProt

P09225

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce cytotoxicity in L929 cells in the presence of vactinomycin D. The ED50 for this effect is <30 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 19.36 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MAX Protein (His Tag)
PKSH033317-01 10 µg

Recombinant Human MAX Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human MAX Protein (His Tag)
PKSH033317-02 50 µg

Recombinant Human MAX Protein (His Tag)

Sign In for Pricing
View Details
RHEB Polyclonal Antibody
E-AB-16645-01 20 µL

RHEB Polyclonal Antibody

Sign In for Pricing
View Details
RHEB Polyclonal Antibody
E-AB-16645-02 60 µL

RHEB Polyclonal Antibody

Sign In for Pricing
View Details
RHEB Polyclonal Antibody
E-AB-16645-03 120 µL

RHEB Polyclonal Antibody

Sign In for Pricing
View Details
RHEB Polyclonal Antibody
E-AB-16645-04 200 µL

RHEB Polyclonal Antibody

Sign In for Pricing
View Details