Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant LIF protein, AF

Leukemia inhibitory factor (LIF) is a pleiotropic glycoprotein, belonging to the IL-6 receptor family. Mouse LIF shares 79% sequence homology with human LIF. LIF is a 19.7 kDa protein containing 202 amino acid which high expression in human liver, bone, uterus, kidney and the central nervous system. LIF is a inducer of differentiation in M1 leukaemia cells, osteoblasts and glia. Not only stimulates proliferation of DA1 cells inhibit proliferation of corticotrophs and promote cell survival in some cell types but also induces apoptosis in others.

Product Specifications

Synonyms

Leukemia inhibitory factor, Differentiation-stimulating factor, D factor, Melanoma-derived LPL inhibitor (MLPLI), Interleukin 6 family cytokine

Gene Name

LIF

UniProt

P09056

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-6 secretion in M1 cells. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse LIF is > 2 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 20.68 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLAD1 Knockout HEK293T Polyclonal Cells
ARG3810 1 Million

FLAD1 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Bovine Keratin Growth Factor ELISA Kit
MBS016137-01 48 Well

Bovine Keratin Growth Factor ELISA Kit

Sign In for Pricing
View Details
Bovine Keratin Growth Factor ELISA Kit
MBS016137-02 96 Well

Bovine Keratin Growth Factor ELISA Kit

Sign In for Pricing
View Details
Bovine Keratin Growth Factor ELISA Kit
MBS016137-03 5x 96 Well

Bovine Keratin Growth Factor ELISA Kit

Sign In for Pricing
View Details
Bovine Keratin Growth Factor ELISA Kit
MBS016137-04 10x 96 Well

Bovine Keratin Growth Factor ELISA Kit

Sign In for Pricing
View Details
Fastk, NT (Fastk, Fas-activated serine/threonine kinase) (Biotin) discontinued
035523-Biotin 200 µL

Fastk, NT (Fastk, Fas-activated serine/threonine kinase) (Biotin) discontinued

Sign In for Pricing
View Details