Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant MMP2 (active) protein, AF

Active matrix metalloproteinase-2 (Active MMP-2) is a 63 kDa matrix metalloproteinases with 558 amino acid residues. MMP-2 is mainly expressed from extracellular matrix organization. Functionally, it can degrade type IV collagen and involves processes of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture.

Product Specifications

Synonyms

Gelatinase A, TBE-1, MMP-II, MONA

Gene Name

MMP2

UniProt

P08253

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Testing in process

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 63.00 kDa. The protein migrates as 66 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Bromo-5-fluorobenzyl alcohol
424453-01 100 mg

3-Bromo-5-fluorobenzyl alcohol

Sign In for Pricing
View Details
3-Bromo-5-fluorobenzyl alcohol
424453-02 250 mg

3-Bromo-5-fluorobenzyl alcohol

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor receptor superfamily member 11B protein (TNFRSF11B)
MBS9423224-01 0.01 mg

Recombinant Human Tumor necrosis factor receptor superfamily member 11B protein (TNFRSF11B)

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor receptor superfamily member 11B protein (TNFRSF11B)
MBS9423224-02 0.05 mg

Recombinant Human Tumor necrosis factor receptor superfamily member 11B protein (TNFRSF11B)

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor receptor superfamily member 11B protein (TNFRSF11B)
MBS9423224-03 0.1 mg

Recombinant Human Tumor necrosis factor receptor superfamily member 11B protein (TNFRSF11B)

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor receptor superfamily member 11B protein (TNFRSF11B)
MBS9423224-04 0.25 mg

Recombinant Human Tumor necrosis factor receptor superfamily member 11B protein (TNFRSF11B)

Sign In for Pricing
View Details