Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-4 (Interleukin-4) protein, AF

Interleukin-4 (IL-4) is a key cytokine produced by activated T cells, mast cells, basophils, neutrophils and eosinophils. IL-4 is critical for the development of Th2-mediated responses, which is related to allergy and asthma. It can also regulate B cell responses, including survival, cell proliferation and gene expression. IL-4 also plays fundamental role for B-cell stimulation, including induction of the IgE isotype switch.

Product Specifications

Synonyms

BCGF, BCDF, B-cell Stimulating Factor (BSF-1)

Gene Name

IL4

UniProt

P07750

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce HT-2 cells proliferation. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant mouse IL-4 is approximately >1 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 14.5 kDa. The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL39 Polyclonal Antibody
E-AB-15214-01 20 µL

MRPL39 Polyclonal Antibody

Sign In for Pricing
View Details
MRPL39 Polyclonal Antibody
E-AB-15214-02 60 µL

MRPL39 Polyclonal Antibody

Sign In for Pricing
View Details
MRPL39 Polyclonal Antibody
E-AB-15214-03 120 µL

MRPL39 Polyclonal Antibody

Sign In for Pricing
View Details
MRPL39 Polyclonal Antibody
E-AB-15214-04 200 µL

MRPL39 Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD86 Antibody[GL-1]
E-AB-F0994L-01 50 Tests

Elab Fluor® 488 Anti-Mouse CD86 Antibody[GL-1]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD86 Antibody[GL-1]
E-AB-F0994L-02 100 Tests

Elab Fluor® 488 Anti-Mouse CD86 Antibody[GL-1]

Sign In for Pricing
View Details