Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant M-CSF (Macrophage colony-stimulating factor) protein, AF

Macrophage Colony-Stimulating Factor (M-CSF) is a 19.02 kDa hematopoietic Growth Factors with 162 amino acid residues. The active form of the protein is homodimer, and secreted by osteoblasts. M-CSF controls the production, differentiation, and function of monocytes, macrophages, and bone marrow progenitor cells. M-CSF is able to activate CSF-1 signaling pathway via binding its receptor CSF-1R.

Product Specifications

Synonyms

CSF-1, MGI-IM

Gene Name

CCL3

UniProt

P07141

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is <2 ng/mL. The specific activity of recombinant mouse M-CSF is approximately >5 x 105 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 19.02 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP withpolyhistidine tag at the C-terminus

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIN2 Human siRNA Oligo Duplex (Locus ID 51411)
SR309766 1 Kit

BIN2 Human siRNA Oligo Duplex (Locus ID 51411)

Sign In for Pricing
View Details
APOBEC3H CRISPR Activation Plasmid (h)
sc-409386-ACT 20 µg

APOBEC3H CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Human S100A11 (S100 Calcium Binding Protein A11) Microsample ELISA Kit
orb2999419-01 48 Tests

Human S100A11 (S100 Calcium Binding Protein A11) Microsample ELISA Kit

Sign In for Pricing
View Details
Human S100A11 (S100 Calcium Binding Protein A11) Microsample ELISA Kit
orb2999419-02 96 Tests

Human S100A11 (S100 Calcium Binding Protein A11) Microsample ELISA Kit

Sign In for Pricing
View Details
C2orf76 sgRNA CRISPR Lentivector (Human) (Target 2)
K0226903 1.0 µg DNA

C2orf76 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ALDH1L1 Protein Vector (Human) (pPB-N-His)
PV001310 500 ng

ALDH1L1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details