Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-6 (Interleukin-6) protein, AF

Interleukin-6 (IL-6) is a pleiotropic, 22-28 kDa cytokine which plays fundamental role in the acute phase response, inflammation, bone metabolism, lymphocyte differentiation and cancer progression. Deregulation of IL-6 production was also found in several diseases, including rheumatoid arthritis, Alzheimer’s disease, autoimmune deficiency disease and different types of cancer.

Product Specifications

Synonyms

IFN-β2, B-Cell Differentiation Factor (BCDF), BSF-2, HPGF, HSF, MGI-2

Gene Name

IL6

UniProt

P05231

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant human IL-6 is approximately >5 x 108 IU/mg. Measure by its ability to induce proliferation in MCF-7 cells. The ED50 for this effect is <4.4 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 21.8 kDa. The protein migrates as 22 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CENPN (NM_001100625) Human Over-expression Lysate
LC420287 20 µg

CENPN (NM_001100625) Human Over-expression Lysate

Sign In for Pricing
View Details
SSB Antibody
KC-883-01 50 μL

SSB Antibody

Sign In for Pricing
View Details
SSB Antibody
KC-883-02 100 µL

SSB Antibody

Sign In for Pricing
View Details
SSB Antibody
KC-883-03 1 mL

SSB Antibody

Sign In for Pricing
View Details
IMMT Polyclonal Antibody
E-AB-10395-01 20 µL

IMMT Polyclonal Antibody

Sign In for Pricing
View Details
IMMT Polyclonal Antibody
E-AB-10395-02 60 µL

IMMT Polyclonal Antibody

Sign In for Pricing
View Details