Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-4 (Interleukin-4) protein, AF

Interleukin-4 (IL-4) is a key cytokine produced by activated T cells, mast cells, basophils, neutrophils and eosinophils. IL-4 is critical for the development of Th2-mediated responses, which is related to allergy and asthma. It can also regulate B cell responses, including survival, cell proliferation and gene expression. IL-4 also plays fundamental role for B-cell stimulation, including induction of the IgE isotype switch.

Product Specifications

Synonyms

BCGF, BCDF, B-cell Stimulating Factor (BSF-1)

Gene Name

IL4

UniProt

P05112

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant human IL-4 is approximately >2.8 x 107 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 15.9 kDa. The protein migrates as 12 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATA7 (C-term) Rabbit Polyclonal Antibody
AP54003PU-N 400 µL

SPATA7 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TMEM132C activation kit by CRISPRa
GA114201 1 Kit

Human TMEM132C activation kit by CRISPRa

Sign In for Pricing
View Details
NADPH oxidase 4 (NOX4) Human Gene Knockout Kit (CRISPR)
KN208007RB 1 Kit

NADPH oxidase 4 (NOX4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Stxbp1 Mouse Gene Knockout Kit (CRISPR)
KN516936 1 Kit

Stxbp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
100X Pluronic F -127
7601A 10 mL

100X Pluronic F -127

Sign In for Pricing
View Details
ELAV2/4 Antibody
8C10486-AAT 50 µg

ELAV2/4 Antibody

Sign In for Pricing
View Details