Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IGF-I (Insulin-like growth factor-I) protein, AF

Insulin like Growth Factors 1 (IGF-I) is a 7.79 kDa member of the Insulin-like Growth Factors with 71 amino acid residues. IGF-I is mainly expressed from liver, adipose tissue, Endometrial stromal cells, Leydig cells, and can be isolated from plasma. IGF-I mediating the protein anabolic and promoting effect of pituitary growth hormone. IGF-I also affects metabolism of glycogen, DNA synthesis and glucose uptake via binding to IGF-I receptor.

Product Specifications

Synonyms

Somatamedin C, IGF-IA

Gene Name

IGF1

UniProt

P05019

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.01 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is 0.9-3.1 ng/mL. The specific activity of recombinant human IGF-I is approximately >1.2 x 103 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 8.59 kDa. The protein migrates as 8-10 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha-Hyodeoxycholic Acid
TRC-H998100-5MG 5 mg

alpha-Hyodeoxycholic Acid

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (SPN/2049R), CF568 conjugate, 0.1mg/mL
BNC682049-500 1x 500 µL

CD43 (T-Cell Marker) (SPN/2049R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RPL7A Mouse Monoclonal Antibody [Clone ID: OTI4C1]
CF811792 100 µg

RPL7A Mouse Monoclonal Antibody [Clone ID: OTI4C1]

Sign In for Pricing
View Details
OXNAD1 (C-term) Rabbit Polyclonal Antibody
AP53140PU-N 400 µL

OXNAD1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NKX2.8 (NKX28/2547), 0.2mg/mL
BNUB2547-100 1x 100 µL

NKX2.8 (NKX28/2547), 0.2mg/mL

Sign In for Pricing
View Details
Resorufin (high purity)
#10062 1x 100 mg

Resorufin (high purity)

Sign In for Pricing
View Details