Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IGF-I (Insulin-like growth factor-I) protein, AF

Insulin Like Growth Factors 1 (IGF-I) is a 7.81 kDa member of the Insulin-like Growth Factors with 71 amino acid residues. IGF-I is mainly expressed from liver, adipose tissue, cervi, endometrial stromal cells, leydig cells, and can be isolated from plasma. IGF-I is mediating the protein anabolic and promoting effect of pituitary growth hormone. IGF-I also affects metabolism of glycogen, DNA synthesis and glucose uptake via binding to IGF-I receptor.

Product Specifications

Synonyms

Somatamedin C, IGF-IA

Gene Name

IGF1

UniProt

P05017

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is <2 ng/mL. The specific activity of recombinant mouse IGF-I is > 5 x 105 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 8.61 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R)-3-Aminoazepan-2-one Hydrochloride
TRC-A583808-50MG 50 mg

(R)-3-Aminoazepan-2-one Hydrochloride

Sign In for Pricing
View Details
CD8 (C8/144B), CF405S conjugate, 0.1mg/mL
BNC040749-100 1x 100 µL

CD8 (C8/144B), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v6 (Marker of Tumor Metastasis) (2F10), CF647 conjugate, 0.1mg/mL
BNC471629-500 1x 500 µL

CD44v6 (Marker of Tumor Metastasis) (2F10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LPL (C-term) Rabbit Polyclonal Antibody
AP23394PU-N 100 µg

LPL (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Intrinsic Factor (GIF) (Center) Rabbit Polyclonal Antibody
AP51837PU-N 400 µL

Intrinsic Factor (GIF) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(5alpha)-Androst-2-en-17-one, 90%
TRC-A637570-5G 5 g

(5alpha)-Androst-2-en-17-one, 90%

Sign In for Pricing
View Details