Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IFN omega (interferon omega) protein, AF

Interferon Omega (IFN-ω) is a 20.12 kDa member of type I IFN family with 173 amino acid residues. IL-28B is expressed by epithelial tissues. IFN-ω with antiviral, antitumor activity and regulating the innate immune response. Able to activate P13K/Akt signaling pathway via binding its receptor IFNAR in cells.

Product Specifications

Synonyms

IFN alpha II-1, IFNW1

Gene Name

IFNW1

UniProt

P05000

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce cytotoxicity in TF-1 cells. The ED50 for this effect is <0.02 ng/mL. The specific activity of recombinant human IFN omega is approximately >5 x107 IU/ mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 20.93 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), 0.2mg/mL
BNUB2602-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), 0.2mg/mL

Sign In for Pricing
View Details
RPLP1 (NM_001003) Human Over-expression Lysate
LY424121 100 µg

RPLP1 (NM_001003) Human Over-expression Lysate

Sign In for Pricing
View Details
CCDC50 Rabbit Polyclonal Antibody
AP54851SU-N 200 µL

CCDC50 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MED15 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F1]
TA807906BM 100 µL

MED15 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F1]

Sign In for Pricing
View Details
FITC Conjugated Lens culinaris Lectin (Lentil) -LcH-
F-1401-1 1 mg

FITC Conjugated Lens culinaris Lectin (Lentil) -LcH-

Sign In for Pricing
View Details
Six2 Mouse Gene Knockout Kit (CRISPR)
KN515812 1 Kit

Six2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details