Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CXCL10 (C-X-C motif chemokine 10) protein, AF

C-X-C motif chemokine 10 (CXCL10) also named Interferon gamma-induced protein 10 (IP-10), which is a chemokine of the intercrine alpha family. CXCL10 is a 8.55kDa protein containing 77 amino acid residues. CXCL10 is produced by the several cell types like monocytes and endothelial cells, which are responded for IFNγ. CXCL10 is a chemotaxis for T cells, NK cells and macrophages. CXCL10 also binds the CXCR3 that induce the cell migration and activation like T cells and dendritic cells.

Product Specifications

Synonyms

IP-10, Gamma-Interferon Inducible Protein 10, Crg-2

Gene Name

CXCL10

UniProt

P02778

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract human PBMCs using a concentration range of 10.0 - 100.0 ng/mL. Note: Results may vary from different PBMC donors.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 9.45 kDa. The protein migrates as 9-11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP with polyhistidine tag at the N-terminus.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEA1 Antibody
GWB-159C74 0.1 mg

TCEA1 Antibody

Sign In for Pricing
View Details
CYP1A1 Recombinant Protein (Mouse)
RP127067 100 µg

CYP1A1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
UPP2, CT (UPP2, Uridine phosphorylase 2) (Biotin) discontinued
043636-Biotin 200 µL

UPP2, CT (UPP2, Uridine phosphorylase 2) (Biotin) discontinued

Sign In for Pricing
View Details
NAGS Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV623084 1.0 µg DNA

NAGS Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Glis1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4272902 1.0 µg DNA

Glis1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
MSK1 (pT581) Blocking Peptide
MBS824238-01 1 mg

MSK1 (pT581) Blocking Peptide

Sign In for Pricing
View Details