Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CXCL7 (C-X-C motif chemokine 7) protein, AF

C-X-C motif chemokine 7 (CXCL7) also named Pro-Platelet basic protein (PPBP), which is a chemokine of the intercrine alpha family. CXCL7is a 7.7 kDa protein containing 70 amino acid residues. CXCL7 is expressed by the platelets, which are activated. During vascular injury, CXCL7 controls the glucose metabolism, mitogenesis and neutrophil recruitment by the interaction with CXCR2.

Product Specifications

Synonyms

Neutrophil Activating Protein-2, NAP-2, PBP (parent molecule), CTAP-III (precursor)

Gene Name

CXCL7

UniProt

P02775

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <0.5 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 8.43 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD with polyhistidine tag at the N-terminus.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPN20B (PTPN20) (NM_015605) Human Untagged Clone
SC100920 10 µg

PTPN20B (PTPN20) (NM_015605) Human Untagged Clone

Sign In for Pricing
View Details
Snta1 (NM_009228) Mouse Recombinant Protein
PM46000M5 20 µg

Snta1 (NM_009228) Mouse Recombinant Protein

Sign In for Pricing
View Details
AT-rich interactive domain-containing protein 5A (ARID5A) Mouse ELISA Kit
B7041 96 Tests

AT-rich interactive domain-containing protein 5A (ARID5A) Mouse ELISA Kit

Sign In for Pricing
View Details
RPL31P17 siRNA Oligos set (Human)
41356171 3x 5 nmol

RPL31P17 siRNA Oligos set (Human)

Sign In for Pricing
View Details
SOD (EC) Antibody
MBS806023-01 0.1 mg

SOD (EC) Antibody

Sign In for Pricing
View Details
SOD (EC) Antibody
MBS806023-02 5x 0.1 mg

SOD (EC) Antibody

Sign In for Pricing
View Details