Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-3 (Interleukin-3) protein, AF

Interleukin-3 (IL-3) is a pleiotropic cytokine which can stimulates the survival, differentiation and proliferation of committed progenitor cells, including megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. IL-3 also enhances phagocytosis and antibody-mediated cellular cytotoxicity. IL-3 binds to IL-3R (IL-3 receptor), which is composed of a unique α subunit (IL-3Rα) and a common β-subunit (βc) .

Product Specifications

Synonyms

MCGF (Mast Cell Growth Factor), Multi-CSF, HCGF, P-cell stimulation factor, Interleukin-3b, BPA, PSF, Csfmu

Gene Name

IL3

UniProt

P01586

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce NFS-60 cells proliferation. The ED50 for this effect is <85 pg/mL. The specific activity of recombinant mouse IL-3 is approximately >1x 107 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 16.04 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCGB1C2 (NM_001097610) Human Over-expression Lysate
LC420399 20 µg

SCGB1C2 (NM_001097610) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant ATP6V1A Antibody
RC-5623-01 50 μL

Recombinant ATP6V1A Antibody

Sign In for Pricing
View Details
Recombinant ATP6V1A Antibody
RC-5623-02 100 µL

Recombinant ATP6V1A Antibody

Sign In for Pricing
View Details
Recombinant ATP6V1A Antibody
RC-5623-03 1 mL

Recombinant ATP6V1A Antibody

Sign In for Pricing
View Details
Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-2), CF647 conjugate, 0.1mg/mL
BNC472592-100 1x 100 µL

Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HOXD8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E3]
TA810941BM 100 µL

HOXD8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E3]

Sign In for Pricing
View Details