Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-3 (Interleukin-3) protein, AF

Interleukin-3 (IL-3) is a pleiotropic cytokine which can stimulates the survival, differentiation and proliferation of committed progenitor cells, including megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. IL-3 also enhances phagocytosis and antibody-mediated cellular cytotoxicity. IL-3 binds to IL-3R (IL-3 receptor), which is composed of a unique α subunit (IL-3Rα) and a common β-subunit (βc) .

Product Specifications

Synonyms

MCGF (Mast Cell Growth Factor), Multi-CSF, HCGF, P-cell stimulation factor, Interleukin-3b, BPA, PSF, Csfmu

Gene Name

IL3

UniProt

P01586

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce NFS-60 cells proliferation. The ED50 for this effect is <85 pg/mL. The specific activity of recombinant mouse IL-3 is approximately >1x 107 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 16.04 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen XVII (COL17A1) Rabbit Polyclonal Antibody
TA368022 100 µL

Collagen XVII (COL17A1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human FUNDC2 activation kit by CRISPRa
GA112274 1 Kit

Human FUNDC2 activation kit by CRISPRa

Sign In for Pricing
View Details
SH3GL2 (NM_003026) Human Over-expression Lysate
LY418947 100 µg

SH3GL2 (NM_003026) Human Over-expression Lysate

Sign In for Pricing
View Details
LIPI Human qPCR Primer Pair (NM_198996)
HP219461 200 Reactions

LIPI Human qPCR Primer Pair (NM_198996)

Sign In for Pricing
View Details
PAFAH1B3 (NM_001145939) Human Over-expression Lysate
LC429044 20 µg

PAFAH1B3 (NM_001145939) Human Over-expression Lysate

Sign In for Pricing
View Details
Cy7 biotin conjugate
3106-AAT 5 mg

Cy7 biotin conjugate

Sign In for Pricing
View Details