Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-1 alpha (Interleukin-1 alpha) protein, AF

Interleukin-1 alpha (IL1 alpha or IL1α) is a member of the interleukin-1 cytokine family, found constitutively present in epithelial layers of the entire gastrointestinal tract, lung, liver, kidney, endothelial cells, and astrocytes. The synthesized IL-1 alpha is a 31 kDa inactive precursor and can be cleaved by intracellular caspase-1 or extracellular proteases to generate the bioactive 17 kDa form and the 16 kDa N-terminal cleavage product. Both precursor and mature IL-1 alpha protein bind to the IL-1 receptor (IL-1R), initiating a cascade of inflammatory cytokines and chemokines production such as IL-6, IL-8, and TNF, in response to viral and bacterial pathogens conditions. IL-1 alpha plays a central role in immune-surveillance mechanisms, stimulating macrophages, neutrophils, and CD8+ T cells activity.

Product Specifications

Synonyms

Hematopoietin-1, Lymphocyte-Activating Factor (LAF), Endogenous Pyrogen (EP), Leukocyte

Gene Name

IL1A

UniProt

P01582

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce D10.G4.1 cells proliferation. The ED50 for this effect is <5 pg/mL. The specific activity of recombinant mouse IL-1 alpha is > 2 x 108 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.93 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aurora A (AURKA) Rabbit Polyclonal Antibody
TA371224 100 µL

Aurora A (AURKA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GTF3C5 (NM_001286709) Human Tagged ORF Clone
RG237607 10 µg

GTF3C5 (NM_001286709) Human Tagged ORF Clone

Sign In for Pricing
View Details
2-tert-Butyl-4-hydroxyanisole
TRC-B699300-500MG 500 mg

2-tert-Butyl-4-hydroxyanisole

Sign In for Pricing
View Details
N-Boc-p-phenylenediamine
TRC-B661725-25G 25 g

N-Boc-p-phenylenediamine

Sign In for Pricing
View Details
Histone H4 (acetyl K16) Recombinant Rabbit monoclonal Antibody
HA750464 100 µL

Histone H4 (acetyl K16) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frs2 Mouse Gene Knockout Kit (CRISPR)
KN306139RB 1 Kit

Frs2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details