Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IFN gamma protein, GMP

The cytokine IFN gamma could protect cells from viral infections and belongs to the family of interferons. A lot of studies have shown that IFN gamma secreted by antigen triggered cell types, including T cells, naive CD4+ T cells, macrophages, dendritic cells, and B cells. IFN gamma plays an important role to trigger the macrophage act against a diverse group of microbial targets, and the pleiotropic molecule associated with antiproliferative, pro-apoptotic and antitumor mechanisms. Based on the effector cytokine considered as a major effector of immunity, it has been used in the treatment of several diseases.

Product Specifications

Synonyms

Type II interferon, T-cell interferon, MAF

Gene Name

IFNG

UniProt

P01579

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell culture, ELISA

Purification

>95% as determined by SDS-PAGE analysis.

Endotoxin

<0.05 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce cytotoxicity in HT29 cells. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant human IFN gamma is approximately >2 x 106 IU/mg, which is calibrated against the human IFN Gamma WHO Reference Material (NIBSC code: 87/586) .

Form

Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved.

Molecular Weight

The protein has a calculated MW of 17.7 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metabotropic Glutamate Receptor 1 (GRM1) (NM_000838) Human Over-expression Lysate
LC400304 20 µg

Metabotropic Glutamate Receptor 1 (GRM1) (NM_000838) Human Over-expression Lysate

Sign In for Pricing
View Details
6-Amino-5-nitrosouracil-13C2
TRC-A618512-25MG 25 mg

6-Amino-5-nitrosouracil-13C2

Sign In for Pricing
View Details
AGAP5 Human Gene Knockout Kit (CRISPR)
KN427075 1 Kit

AGAP5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GCSF Receptor (CSF3R) (NM_156039) Human Over-expression Lysate
LC403523 20 µg

GCSF Receptor (CSF3R) (NM_156039) Human Over-expression Lysate

Sign In for Pricing
View Details
Gemin8 (BC023488) Mouse Tagged ORF Clone
MG202283 10 µg

Gemin8 (BC023488) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Synaptophysin Rabbit Polyclonal Antibody
0407-2 100 µL

Synaptophysin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details