Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IFN gamma protein, GMP

The cytokine IFN gamma could protect cells from viral infections and belongs to the family of interferons. A lot of studies have shown that IFN gamma secreted by antigen triggered cell types, including T cells, naive CD4+ T cells, macrophages, dendritic cells, and B cells. IFN gamma plays an important role to trigger the macrophage act against a diverse group of microbial targets, and the pleiotropic molecule associated with antiproliferative, pro-apoptotic and antitumor mechanisms. Based on the effector cytokine considered as a major effector of immunity, it has been used in the treatment of several diseases.

Product Specifications

Synonyms

Type II interferon, T-cell interferon, MAF

Gene Name

IFNG

UniProt

P01579

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell culture, ELISA

Purification

>95% as determined by SDS-PAGE analysis.

Endotoxin

<0.05 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce cytotoxicity in HT29 cells. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant human IFN gamma is approximately >2 x 106 IU/mg, which is calibrated against the human IFN Gamma WHO Reference Material (NIBSC code: 87/586) .

Form

Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved.

Molecular Weight

The protein has a calculated MW of 17.7 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CUTA activation kit by CRISPRa
GA109892 1 Kit

Human CUTA activation kit by CRISPRa

Sign In for Pricing
View Details
Human GRP56, C-His, Flag Tag (ECD)
HA210812-01 20 µg

Human GRP56, C-His, Flag Tag (ECD)

Sign In for Pricing
View Details
Human GRP56, C-His, Flag Tag (ECD)
HA210812-02 50 µg

Human GRP56, C-His, Flag Tag (ECD)

Sign In for Pricing
View Details
Human GRP56, C-His, Flag Tag (ECD)
HA210812-03 100 µg

Human GRP56, C-His, Flag Tag (ECD)

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), Biotin conjugate, 0.1mg/mL
BNCB0226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NSE (ENO2) Mouse Monoclonal Antibody [Clone ID: OTI6E11]
CF813804 100 µg

NSE (ENO2) Mouse Monoclonal Antibody [Clone ID: OTI6E11]

Sign In for Pricing
View Details