Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IFN beta 1a (Interferon beta 1a) protein, AF

Interferon Beta 1a (IFN beta 1a) is a leukocyte interferon, which is a variant of Interferon beta. IFN beta 1a is a 17.87 kDa protein containing 161 amino acid residues. It could bind the interferon receptors that activates the signal transduction of immune responses through the Jak/STAT pathway in leukocytes and lymphoblastoid cells.

Product Specifications

Synonyms

IFNB1, Type I Interferon

Gene Name

IFNB1

UniProt

P01575

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to protect HeLa cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <5 pg/mL. The specific activity of recombinant mouse IFN beta 1a is > 1 x 10^9 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 20.68 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN with polyhistidine tag at the C-terminus

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CNO (BLOC1S4) activation kit by CRISPRa
GA110710 1 Kit

Human CNO (BLOC1S4) activation kit by CRISPRa

Sign In for Pricing
View Details
NTE (PNPLA6) (NM_001166111) Human Over-expression Lysate
LY431706 100 µg

NTE (PNPLA6) (NM_001166111) Human Over-expression Lysate

Sign In for Pricing
View Details
ASAH1 Rabbit Polyclonal Antibody
TA373716 100 µL

ASAH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-Carbamyl-L-glutamic Acid-d5
TRC-C175967-5MG 5 mg

N-Carbamyl-L-glutamic Acid-d5

Sign In for Pricing
View Details
PARK7 Antibody
KC-799-01 50 μL

PARK7 Antibody

Sign In for Pricing
View Details
PARK7 Antibody
KC-799-02 100 µL

PARK7 Antibody

Sign In for Pricing
View Details