Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant beta-NGF (Nerve growth factor-beta) protein, AF

Beta-Nerve Growth Factors (Beta-NGF) is a 27 kDa cytokine with 241 amino acid residues. Beta-NGF belongs to neurotrophin family, and acts as neurotrophic factors. It's composed of alpha, beta, gamma subnuits, and the beta subunit is related to its biological activity. Beta-NGF binds to p75 neurotrophin receptor and Trk receptor and their function is about cell death and survival, respectively.

Product Specifications

Synonyms

β-Nerve Growth Factor, NGF-β

Gene Name

NGF

UniProt

P01139

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <1ng/mL. The specific activity of recombinant mouse beta-NGF is > 1 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 14.41 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSA TOTAL Monoclonal Antibody (Capture)
orb25986 1 mg

PSA TOTAL Monoclonal Antibody (Capture)

Sign In for Pricing
View Details
Recombinant Cronobacter sakazakii UPF0271 protein ESA_02634 (ESA_02634)
MBS1070419-01 0.02 mg (E-Coli)

Recombinant Cronobacter sakazakii UPF0271 protein ESA_02634 (ESA_02634)

Sign In for Pricing
View Details
Recombinant Cronobacter sakazakii UPF0271 protein ESA_02634 (ESA_02634)
MBS1070419-02 0.1 mg (E-Coli)

Recombinant Cronobacter sakazakii UPF0271 protein ESA_02634 (ESA_02634)

Sign In for Pricing
View Details
Recombinant Cronobacter sakazakii UPF0271 protein ESA_02634 (ESA_02634)
MBS1070419-03 0.02 mg (Yeast)

Recombinant Cronobacter sakazakii UPF0271 protein ESA_02634 (ESA_02634)

Sign In for Pricing
View Details
Recombinant Cronobacter sakazakii UPF0271 protein ESA_02634 (ESA_02634)
MBS1070419-04 0.1 mg (Yeast)

Recombinant Cronobacter sakazakii UPF0271 protein ESA_02634 (ESA_02634)

Sign In for Pricing
View Details
Recombinant Cronobacter sakazakii UPF0271 protein ESA_02634 (ESA_02634)
MBS1070419-05 0.02 mg (Baculovirus)

Recombinant Cronobacter sakazakii UPF0271 protein ESA_02634 (ESA_02634)

Sign In for Pricing
View Details