Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant beta-NGF (Nerve growth factor-beta) protein, AF

Nerve Growth Factors (NGF) is critical for the development and maintenance of the sympathetic and sensory neuron systems. NGF has been demonstrated as a complex that consists of three polypeptides named α, β and γ subunits. Among then, β subunit, which known as beta-NGF is a 26.9 kDa protein containing 241 residues that involve in neuronal survival and differentiation. Besides, beta-NGF also acts as a ligand to TRKA receptor, which indispensable for the differentiation and development of pain and temperature sensing neurons.

Product Specifications

Synonyms

β-Nerve Growth Factor, NGF-β

Gene Name

NGF

UniProt

P01138

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <0.7 ng/mL. The specific activity of recombinant human beta-NGF is > 1 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 14.43 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon: sigmoid
CS634372 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3527), Biotin conjugate, 0.1mg/mL
BNCB3527-500 1x 500 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3527), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
rac-Trifluorolactic Acid
TRC-T790495-25G 25 g

rac-Trifluorolactic Acid

Sign In for Pricing
View Details
Crude Sophora japonica (Pagoda Tree) -SJA-20mg
L-2900-20 20 mg

Crude Sophora japonica (Pagoda Tree) -SJA-20mg

Sign In for Pricing
View Details
CLPP Antibody
KC-3166-01 50 μL

CLPP Antibody

Sign In for Pricing
View Details
CLPP Antibody
KC-3166-02 100 µL

CLPP Antibody

Sign In for Pricing
View Details