Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant TGF alpha (Transforming growth factor alpha) protein, AF

Transforming Growth Factors alpha (TGF-α) is a 5.68 kDa member of the epidermal Growth Factors with 51 amino acid residues. TGF-α is mainly expressed from brain, skin, epithelial cell (pancreatic endocrine cells, urothelial cells, oligodendrocyte precursor cells, etc.) . TGF-α is a regulator of cell proliferation and differentiation via bind to the EGFR and to act synergistically with TGF β. TGF-α also associates with myriad forms of cancer.

Product Specifications

Synonyms

Sarcoma growth factor, TGF-type I, ETGF, TGFA

Gene Name

TGFA

UniProt

P01135

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant human TGF alpha is > 5 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. In some experiments, it recommends to add 10 mM HCl when reconstitute lyophilized protein. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 6.49 kDa. The protein migrates as 7 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS803874 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS800423 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
ATRNL1 Rabbit Polyclonal Antibody
TA373858 100 µL

ATRNL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ME3 (NM_001014811) Human Over-expression Lysate
LY423083 100 µg

ME3 (NM_001014811) Human Over-expression Lysate

Sign In for Pricing
View Details
FAM136BP (NM_001012983) Human Over-expression Lysate
LC425341 20 µg

FAM136BP (NM_001012983) Human Over-expression Lysate

Sign In for Pricing
View Details
APC Mouse IgG2a, κ Isotype Control
RD22446F-01 25 µg

APC Mouse IgG2a, κ Isotype Control

Sign In for Pricing
View Details