Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant EGF (Epidermal growth factor) protein, AF

Human epidermal Growth Factors (EGF) is a 6 kDa cytokine with 53 amino acid residues. EGF is mainly secreted from ectodermal cells, monocytes, kidney and duodenal glands. Upon binding to its receptor, EGFR, EGF acts to stimulate cell growth and proliferation of epithelial cells, play important roles in many developmental processes including accelerate tooth eruption, inhibits gastric acid secretion, and involve in wound healing.

Product Specifications

Synonyms

Urogastrone, URG

Gene Name

EGF

UniProt

P01133

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 1.0 ng/mL. The specific activity of recombinant human EGF is approximately >1.0 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 7.16 kDa. The protein migrates as 9-11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR with polyhistidine tag at the C-terminus

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sec63 HDR Plasmid (m)
sc-431236-HDR 20 µg

Sec63 HDR Plasmid (m)

Sign In for Pricing
View Details
Ataxin 10 (ATXN10) Magnetic Luminex Assay Kit
LKU602533 96 Tests

Ataxin 10 (ATXN10) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
STAT 5a, b, phosphorylated (Tyr694/699) (Signal Transducer and Activator of Transcription 5a, b) (MaxLight 405) discontinued
S7972-14A-ML405 100 µL

STAT 5a, b, phosphorylated (Tyr694/699) (Signal Transducer and Activator of Transcription 5a, b) (MaxLight 405) discontinued

Sign In for Pricing
View Details
3-[ (Benzyloxy) methyl]-1- ({[ (9H-fluoren-9-yl) methoxy]carbonyl}amino) cyclobutane-1-carboxylic acid
XLD57279-01 50 mg

3-[ (Benzyloxy) methyl]-1- ({[ (9H-fluoren-9-yl) methoxy]carbonyl}amino) cyclobutane-1-carboxylic acid

Sign In for Pricing
View Details
3-[ (Benzyloxy) methyl]-1- ({[ (9H-fluoren-9-yl) methoxy]carbonyl}amino) cyclobutane-1-carboxylic acid
XLD57279-02 0.5 g

3-[ (Benzyloxy) methyl]-1- ({[ (9H-fluoren-9-yl) methoxy]carbonyl}amino) cyclobutane-1-carboxylic acid

Sign In for Pricing
View Details
MRGPRX3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV627146 1.0 µg DNA

MRGPRX3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details