Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant EGF (Epidermal growth factor) protein, AF

Human epidermal Growth Factors (EGF) is a 6 kDa cytokine with 53 amino acid residues. EGF is mainly secreted from ectodermal cells, monocytes, kidney and duodenal glands. Upon binding to its receptor, EGFR, EGF acts to stimulate cell growth and proliferation of epithelial cells, play important roles in many developmental processes including accelerate tooth eruption, inhibits gastric acid secretion, and involve in wound healing.

Product Specifications

Synonyms

Urogastrone, URG

Gene Name

EGF

UniProt

P01133

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 1.0 ng/mL. The specific activity of recombinant human EGF is approximately >1.0 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 7.16 kDa. The protein migrates as 9-11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR with polyhistidine tag at the C-terminus

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Proteoglycan 4 (PRG4) ELISA Kit
orb1807246-01 48 Tests

Human Proteoglycan 4 (PRG4) ELISA Kit

Sign In for Pricing
View Details
Human Proteoglycan 4 (PRG4) ELISA Kit
orb1807246-02 96 Tests

Human Proteoglycan 4 (PRG4) ELISA Kit

Sign In for Pricing
View Details
OTTMUSG00000016609 Protein Lysate (Mouse) with C-HA Tag
35816034 100 µg

OTTMUSG00000016609 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Phospho-EEF2k (Ser359) Antibody Blocking Peptide
orb1513585 500 µg

Phospho-EEF2k (Ser359) Antibody Blocking Peptide

Sign In for Pricing
View Details
Zinc Alpha 2 Glycoprotein Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-62121R-BF680 100 µL

Zinc Alpha 2 Glycoprotein Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Polyclonal Antibody to Macrophage Inflammatory Protein 3 Beta (MIP3b)
TRV-0050366-01 20 µL

Polyclonal Antibody to Macrophage Inflammatory Protein 3 Beta (MIP3b)

Sign In for Pricing
View Details