Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant BMP-15 (Bone morphogenetic protein-15) protein, AF

Bone Morphogenetic Protein-15 (BMP-15) is an extracellular multifunctional signaling cytokine that is also a member of the TGFβ family. In the ovarian follicles, BMP-15 has a vital role in regulating the growth and maturation of follicles, the sensitivity of granulosa cells to FSH, and preventing granulosa cells from apoptosis. In addition, BMP-15 and GDF9 cooperate and have the same interaction on target cells.

Product Specifications

Synonyms

Growth/Differentiation Factor-9B, GDF-9B, ODG2, POF4

Gene Name

BMP15

UniProt

O95972

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <17 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 14.88 kDa. The protein migrates as 13-18 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MQADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR with polyhistidinetag at the C- terminus

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUCA1 Polyclonal Antibody
E-AB-15050-01 20 µL

FUCA1 Polyclonal Antibody

Sign In for Pricing
View Details
FUCA1 Polyclonal Antibody
E-AB-15050-02 60 µL

FUCA1 Polyclonal Antibody

Sign In for Pricing
View Details
FUCA1 Polyclonal Antibody
E-AB-15050-03 120 µL

FUCA1 Polyclonal Antibody

Sign In for Pricing
View Details
FUCA1 Polyclonal Antibody
E-AB-15050-04 200 µL

FUCA1 Polyclonal Antibody

Sign In for Pricing
View Details
ExoBriteTM 515/540 True EV Membrane Stain, 500 labelings
#30129 1x 500 µL

ExoBriteTM 515/540 True EV Membrane Stain, 500 labelings

Sign In for Pricing
View Details
Monkey EGFR Antibody Pair Set
E-KAB-0671 50 µL & 100 µg

Monkey EGFR Antibody Pair Set

Sign In for Pricing
View Details