Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant BMP-10 (Bone morphogenetic protein-10) protein, AF

Bone Morphogenetic Protein-10 (BMP-10) is an extracellular multifunctional signaling cytokine that is also a member of the TGFβ family. BMP-10 can bind with TGFβ receptor and is involved in SMAD protein signal transduction. The functions related to bone generation can induce bone and cartilage formation. Different from other family members, BMP-10 is a novel protein involved in the heart's trabeculation.

Product Specifications

Gene Name

BMP10

UniProt

O95393

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 1.7-2.1 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 13.10 kDa. The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), CF568 conjugate, 0.1mg/mL
BNC681908-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C19orf80 (ANGPTL8) Human Gene Knockout Kit (CRISPR)
KN418000 1 Kit

C19orf80 (ANGPTL8) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Myoglobin (Muscle Cell Marker) (MB/2105), Biotin conjugate, 0.1mg/mL
BNCB2105-100 1x 100 µL

Myoglobin (Muscle Cell Marker) (MB/2105), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
kynurenine 3 monooxygenase (KMO) (NM_003679) Human Recombinant Protein
TP710125 20 µg

kynurenine 3 monooxygenase (KMO) (NM_003679) Human Recombinant Protein

Sign In for Pricing
View Details
Human CEP78 activation kit by CRISPRa
GA113383 1 Kit

Human CEP78 activation kit by CRISPRa

Sign In for Pricing
View Details
FAM177B (NM_207468) Human Over-expression Lysate
LC404043 20 µg

FAM177B (NM_207468) Human Over-expression Lysate

Sign In for Pricing
View Details