Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant CD27L (CD27 ligand) protein, AF

CD27L is also named for CD70 which is one member of TNF family. CD27L is expressed on T and B lymphocytes and mature DCs. It binds the CD27, which is on the antigen-presenting cells. CD27L is a 19.2 kDa cytokine with 148 amino acid residues which is a transmembrane glycoprotein. CD27L plays an important role in the regulation of T cell proliferation which is also a good target of cancer immunotherapy.

Product Specifications

Synonyms

Soluble CD27 Ligand, sCD27 Ligand, TNFSF7, CD70, Tnfs, Tnlg8a

Gene Name

CD70

UniProt

O55237

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in mouse T cells in the presence of the anti-CD3 antibody. The ED50 for this effect is <4.5 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 17.25 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPANXB1 Mouse Monoclonal Antibody [Clone ID: OTI6G2]
CF811401 100 µg

SPANXB1 Mouse Monoclonal Antibody [Clone ID: OTI6G2]

Sign In for Pricing
View Details
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3496), CF594 conjugate, 0.1mg/mL
BNC943496-100 1x 100 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3496), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BstFNI, 100U
RE1220 100 U

BstFNI, 100U

Sign In for Pricing
View Details
CD79a (IGA/1688R), 0.2mg/mL
BNUB1688-100 1x 100 µL

CD79a (IGA/1688R), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human EphA4 Protein (aa 570-986, His &GST Tag)
PKSH030369 50 µg

Recombinant Human EphA4 Protein (aa 570-986, His &GST Tag)

Sign In for Pricing
View Details
Recombinant Human GAD1GAD, GAD67 protein (His tag)
PDEH101044-01 20 µg

Recombinant Human GAD1GAD, GAD67 protein (His tag)

Sign In for Pricing
View Details