Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant TWEAK (TNF-related weak inducer of apoptosis) protein, AF

TNF-related Weak Inducer of Apoptosis (TWEAK) is a type II membrane protein of the tumor necrosis factor (TNF) family members, high levels expression in mouse peritoneal macrophages. The murine and human TWEAK homologs are very close related (~93% sequence identity in the receptor-binding domain) . TWEAK is a 17.3 kDa protein containing 129 residues. TWEAK induce apoptosis through cognate receptor Fn14 activate caspase-8 and caspase-3, in HSC3 cells KATO-III gastric adenocarcinoma cells and IFN-γ-treated HT-29. TWEAK stimulate inflammatory cytokines in HT-29, A375 cells, WI-38 fibroblast sand astrocytes.

Product Specifications

Synonyms

TNFSF12, DR3LG, Apo3 Ligand, AI255180, C87282, Fn1, Fn14, HPIP, TWEAK-R, Twea, TweakR, Tnfrsf12a

Gene Name

TNFSF12

UniProt

O54907

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is <0.2 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.14 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MSAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mLC1SA (MYL6B) Human Gene Knockout Kit (CRISPR)
KN402076 1 Kit

mLC1SA (MYL6B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL2 Antibody
KC-347-01 50 μL

IL2 Antibody

Sign In for Pricing
View Details
IL2 Antibody
KC-347-02 100 µL

IL2 Antibody

Sign In for Pricing
View Details
IL2 Antibody
KC-347-03 1 mL

IL2 Antibody

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3226), CF640R conjugate, 0.1mg/mL
BNC403226-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3226), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MRC2 Human Gene Knockout Kit (CRISPR)
KN421360 1 Kit

MRC2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details