Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-16 (Interleukin-16) protein, AF

Interleukin 16 (IL-16) predicts a molecular mass of 13.5 kDa, encoded by this gene is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T cell activation, and an inhibitor of HIV replication, and signaling process of this cytokine is mediated by CD4.

Product Specifications

Synonyms

LCF (Lymphocyte Chemoattractant Factor), mKIAA4048

Gene Name

Il16

UniProt

O54824

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Testing in process

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 14.04 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MHDLNSSTDSAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGDRTGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Pleura
CS705929 5x 5 µm

Tissue FFPE Sections, Pleura

Sign In for Pricing
View Details
Live-or-DyeTM 405/452 Fixable Viability Staining Kit, Trial Size (50 assays)
#32003-T 1 Kit

Live-or-DyeTM 405/452 Fixable Viability Staining Kit, Trial Size (50 assays)

Sign In for Pricing
View Details
Histone H3 (mono methyl R2) Recombinant Rabbit monoclonal Antibody
HA750197 100 µL

Histone H3 (mono methyl R2) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Slc7a5 Mouse Gene Knockout Kit (CRISPR)
KN516196 1 Kit

Slc7a5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat IgG (Fcγ Fragment specific), AlpSdAbs® VHH
HA710287 100 µg

Rat IgG (Fcγ Fragment specific), AlpSdAbs® VHH

Sign In for Pricing
View Details
Human SNX5 activation kit by CRISPRa
GA109027 1 Kit

Human SNX5 activation kit by CRISPRa

Sign In for Pricing
View Details