Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CXCL13 (C-X-C motif chemokine 13) protein, AF

C-X-C motif chemokine 13 (CXCL13) also named B lymphocyte chemoattractant (BLC), which is a chemokine of the intercrine alpha family. CXCL13 is a 7.9kDa protein containing 72 amino acid residues. CXCL13 is a chemotaxis for B lymphocyte. CXCL13 induces the cell proliferation though the AKT signal pathway which plays a key role intestinal cancer model. CXCL13 /CXCR5 axis is highly existed in gut, spleen and lymph nodes.

Product Specifications

Synonyms

B-cell Attracting Chemokine-1, BLR1 Ligand, BCA-1/BLC

Gene Name

CXCL13

UniProt

O43927

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR5. The ED50 for this effect is <20 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 9.49 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR with polyhistidine tag at the N-terminus.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cyclin B2 Antibody (X29.2) [PE]
NBP3-08843PE 0.1 mL

Mouse Monoclonal Cyclin B2 Antibody (X29.2) [PE]

Sign In for Pricing
View Details
Syntrophin (SNTB1) Rabbit Polyclonal Antibody
TA362332 100 µL

Syntrophin (SNTB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hsa-miR-5681a miRNA Inhibitor
CIH1832-01 10 nmol

Hsa-miR-5681a miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-5681a miRNA Inhibitor
CIH1832-02 20 nmol

Hsa-miR-5681a miRNA Inhibitor

Sign In for Pricing
View Details
TLK1 (NM_001136554) Human Untagged Clone
SC325302 10 µg

TLK1 (NM_001136554) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Monoclonal MICA/B Antibody (6D4) [Alexa Fluor 350]
NBP2-76811AF350 0.1 mL

Mouse Monoclonal MICA/B Antibody (6D4) [Alexa Fluor 350]

Sign In for Pricing
View Details